PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12932A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 255aa    MW: 28135.9 Da    PI: 6.5211
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12932AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.9e-12129173347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE+ l++++ +++G+g Wk+ + +  +++t+ q+ s+ qk+
  Oropetium_20150105_12932A 129 KWTKEEHSLFLEYLEKHGPGKWKAMSTEYLTTKTAFQIASHHQKH 173
                                8****************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.171665IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-71967IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-42064IPR009057Homeodomain-like
PROSITE profilePS500905.9352063IPR017877Myb-like domain
PROSITE profilePS5129413.204122178IPR017930Myb domain
SuperFamilySSF466896.96E-13124178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-8125173IPR006447Myb domain, plants
SMARTSM007171.9E-8126176IPR001005SANT/Myb domain
PfamPF002492.0E-10128173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-11128175IPR009057Homeodomain-like
CDDcd001672.48E-7129169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MPHANDAGAA PVLPEPVAMW TRSDDKLLEL LLLVPYFQRW DMIASRFVGK TLEQVYQRYE  60
RTVDEVTRIL HAPEVETPRE WDVQSAVAAS PEAVAAPAAA ATDAAASSEP GAAAATKRKR  120
KAERKKPEKW TKEEHSLFLE YLEKHGPGKW KAMSTEYLTT KTAFQIASHH QKHCKRLEQR  180
KLKLCKRASI HDITEPTRAA AVGGVGDPAV QKEDELGRGV GPAEPKAPGP GEPAAPDVED  240
FFGEYDDLGP FFMW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A8Z2S61e-61A0A0A8Z2S6_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144181825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.12e-16MYB family protein